PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MELO3C010724P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family Trihelix
Protein Properties Length: 398aa    MW: 45412.8 Da    PI: 6.4585
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MELO3C010724P1genomeMELONOMICSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix84.81.1e-2673154286
        trihelix   2 WtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqle 86 
                     W ++e++ Li++rrem+  ++++k++k+lWe++s+kmrergf rsp++C++kw+nl k++kk k+++++     s +++ ++++e
  MELO3C010724P1  73 WVQDETRSLIALRREMDGLFNTSKSNKHLWEQISAKMRERGFDRSPTMCTDKWRNLLKEFKKAKHQDRGS---GSAKMSCYKEIE 154
                     *******************************************************************984...445778888886 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500908.57165129IPR017877Myb-like domain
Gene3DG3DSA:1.10.10.601.2E-466131IPR009057Homeodomain-like
SMARTSM007175.4E-569131IPR001005SANT/Myb domain
CDDcd122035.23E-2971136No hitNo description
PfamPF138371.1E-2072156No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0042802Molecular Functionidentical protein binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 398 aa     Download sequence    Send to blast
MYLSDKPRPI DIYKEEGSRD MMIEVASNGD HHIQPHQPQP QPQQTHQQHQ MMLGDSSGED  60
HEVKAPKKRA ETWVQDETRS LIALRREMDG LFNTSKSNKH LWEQISAKMR ERGFDRSPTM  120
CTDKWRNLLK EFKKAKHQDR GSGSAKMSCY KEIEEILKER SKSTQYKSPT PPKIDSYMQF  180
SDKGIEDNGL SFGPVEGGRP SLNLERQLDH DGHPLAITAA DAVAATGIPP WNWREAPGNG  240
GESQAFGGRV ISVKWGDYTR RIGVDGTAEA IKEAIKSAFG LRTKRAFWLE DEDQVVRSLD  300
RDMPLGNYTL HLDEGVAVKI CLYDESNHLP VHSEDKVFYI EEDYRDFLAR RGWTSLREFD  360
GYRNIDNIDD LRSGALYRRN IDNMDDLRPG AIYRGVS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2jmw_A1e-4967152186DNA binding protein GT-1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00004PBMTransfer from 920224Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818230.0LN681823.1 Cucumis melo genomic scaffold, anchoredscaffold00014.
GenBankLN7132570.0LN713257.1 Cucumis melo genomic chromosome, chr_3.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008444421.10.0PREDICTED: trihelix transcription factor GT-1-like isoform X2
SwissprotQ9FX530.0TGT1_ARATH; Trihelix transcription factor GT-1
TrEMBLA0A0A0LKN90.0A0A0A0LKN9_CUCSA; Uncharacterized protein
STRINGGLYMA11G37390.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF68173248
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G13450.10.0Trihelix family protein